|
Recombinant Mouse IL2(Interleukin-2) |
||||||
|
|
|
Cat.No.: |
CYT- P60568 |
|
|
|
|
Product Background |
||||||
|
Recombinant Mouse Interleukin-2(IL2) |
||||||
|
IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. It is expressed by CD4+ and CD8+ T cells, ¦Ã¦Ä T cells, B cells, dendritic cells, and eosinophils. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions which are essential for the immune response. The receptor for IL2 consists of three subunits (55 kDa IL2R¦Á, 75 kDa IL2R¦Â, 64 kDa common gamma chain ¦Ãc/IL2R¦Ã) that are present on the cell surface in varying preformed complexes; Mature mouse IL2 shares 56 % and 73 % amino acid sequence identity with human and rat IL2 respectively. Mouse and human IL2 exhibit cross-species activity. Mouse IL2 has a specific N-terminal region that contains a poly glutamine (contain 12 glutamines) stretch. |
||||||
|
Product Information |
||||||
|
Source |
Escherichia coli. |
|||||
|
Molecular Weight |
17.4 KDa,Recombinant Mouse Interleukin-2 is produced by our E.coli expression system and the target gene encoding Ala21-Gln169 is expressed. |
|||||
|
AA Sequence |
APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLT FKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSD NTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ |
|||||
|
Biological Activity |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine CTLL-2 cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 ¡Á 106 IU/mg. |
|||||
|
Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
|||||
|
Formulation |
Lyophilized from a 0.2 µm filtered solution in PBS, pH 7.4. |
|||||
|
Endotoxin |
Less than 1 EU/µg of rMuIL-2 as determined by LAL method. |
|||||
|
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ¡Ü -20 ¡ãC. Further dilutions should be made in appropriate buffered solutions. |
|||||
|
Purity |
> 95 % by SDS-PAGE and HPLC analyses. |
|||||
|
Stability & Storage |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
|||||
|
12 months from date of receipt, -20 to -70 ¡ãC as supplied. |
||||||
|
1 month, 2 to 8 ¡ãC under sterile conditions after reconstitution. |
||||||
|
3 months, -20 to -70 ¡ãC under sterile conditions after reconstitution. |
||||||
|
Usage Information |
||||||
|
This product is offered by InCellGen only for Scientific Research & Laboratory USE. NOT FOR OTHER USE. |
||||||
|
Order Information |
|
|
|
|
|
|
|
Cata.No. |
Quantity |
Price($) |
Price($) |
Price(£¤) |
||
|
CYT- P60568 |
10ug |
$120.00 |
€132.00 |
£¤1,200.00 |
||
|
CYT- P60568 |
50ug |
$260.00 |
€286.00 |
£¤2,600.00 |
||
|
CYT- P60568 |
1mg |
$2,880.00 |
€3,168.00 |
£¤28,800.00 |
||
|
Free Delivery on orders over $200.00. |
||||||
|
We Devoted Ourselves To The Development Of Biomedical Research Reagent. |
||||||
