Recombinant Human IGF-2,CYT-P01344

Description

IGF2 Protein, Human is a mitogenic cytokine that exerts its effects by binding to the IGF type 1 receptor. It plays a crucial role in modulating the growth and development of a wide variety of tissues, including nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone.

Research Background

Insulin-like Growth Factors (IGFs) are key regulators of growth for numerous tissues such as the nervous system, lymphoid organs, reproductive organs, smooth muscle, endothelium, and bone. Human Insulin-like Growth Factor 2 (IGF-II) is produced by osteoblasts, and its mitogenic actions are mediated through its binding to plasma membrane IGF receptors. The IGF Type 1 receptor, which binds both IGF-I and IGF-II, is considered the primary receptor responsible for mediating the effects of these growth factors in most cell types, including osteoblasts.

Biological Activity

The biological activity of this product has been validated through the following methods:

- The ED50 is <20 ng/mL as measured by a cell proliferation assay using FDCP-1 cells, corresponding to a specific activity of >5 ¡Á 10⁴ units/mg.

- Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 3.658 ng/mL, corresponding to a specific activity of 2.733 ¡Á 10⁵ units/mg.

Product Details

Species:Human

Expression System:E. coli

Tag:Tag Free

Protein Number (Accession):P01344-1

Amino Acid Sequence (Region):A25-E91

Gene ID:3481 [NCBI]

Protein Length:Full Length of IGF2 (Mature Form)

Synonyms:rHuIGF-2; Somatamedin A; IGF-II

Amino Acid Sequence

MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Weight:Approximately 8-11 kDa, as determined by SDS-PAGE under reducing conditions.

Purity:¡Ý 95%, as determined by reducing SDS-PAGE.

Form:Sterile lyophilized powder.

Endotoxin Level:<1 EU/¦Ìg, determined by the LAL method.

Composition

The product is lyophilized from a 0.22 ¦Ìm filtered solution. The specific buffer composition varies by lot. Please refer to the lot-specific Certificate of Analysis (COA) for details. Possible buffer formulations include:PBS, pH 7.4.

Note for SPR Assays: If using this product for Surface Plasmon Resonance (SPR), please note that primary amine components (e.g., Tris) in the buffer can affect the coupling of the protein to the chip. You may need to replace the buffer.

Reconstitution

It is recommended to reconstitute the lyophilized powder in sterile ddH₂O to a concentration of at least 100 ¦Ìg/mL.For long-term storage after reconstitution, it is highly recommended to add a carrier protein such as 0.1% BSA, 5% HSA, 10% FBS, or 5% Trehalose to prevent adsorption and loss of activity.

Storage and Stability

Storage (Lyophilized): Store at -20¡ãC. Under these conditions, the product is stable for 2 years from the date of receipt.

Storage (Reconstituted):Stable at 4¡ãC for up to 1 week.For longer storage, aliquot and store at -20¡ãC or -80¡ãC. The addition of a carrier protein is recommended for extended stability.

- Handling: Avoid repeated freeze-thaw cycles.

Shipping:Shipped at room temperature within the continental US. Conditions may vary for international shipments.

Order Information

For Research Use Only. Not for use in diagnostic or therapeutic procedures.