|
Recombinant Mouse IL36 gamma |
|||||
|
Cat.No.:REM-Q8R460 |
|||||
|
Product Background |
|||||
|
Recombinant Mouse IL-36 gamma (IL-1F9) |
|||||
|
IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 gamma/IL-1F9 Protein, Mouse is a recombinant mouse IL-36 gamma (G13-S164) without any tag, which is produced in E. coli. |
|||||
|
Product Information |
|||||
|
Source |
E.coli |
||||
|
Molecular Weight |
17 kDa(13-164AA) |
||||
|
AA Sequence |
GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPE SLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEP MKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS |
||||
|
Tag Information |
Tag Free |
||||
|
Physical Appearance |
Liquid or Lyophilized powder |
||||
|
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20 mM MOPS, 10 mM TCEP, 150 mM NaCl, pH 7.4. |
||||
|
Endotoxin |
Less than 1 EU/mg of Recombinant Protein as determined by LAL method. |
||||
|
Reconstitution |
Always centrifuge tubes before opening.Do not mix by vortex or pipetting. |
||||
|
Purity |
>90 % by SDS-PAGE. |
||||
|
Stability & Storage |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
||||
|
12 months from date of receipt, -20 to -80 °C as supplied. |
|||||
|
1 month, 2 to 8 °C under sterile conditions after reconstitution. |
|||||
|
3 months, -20 to -70 °C under sterile conditions after reconstitution. |
|||||
|
Usage Information |
|||||
|
This product is offered by InCellGen only for Scientific Research & Laboratory USE. NOT FOR OTHER USE. |
|||||
|
Order Information |
|
||||
|
Quantity |
Price($） |
Price(�) |
Price(￥/CNY） |
Price(￥/JYP） |
|
|
10ug |
$220.00 |
� 264.00 |
￥2,200.00 |
￥43,780.00 |
|
|
50ug |
$680.00 |
� 816.00 |
￥6,800.00 |
￥135,320.00 |
|
|
1mg |
$3,600.00 |
� 4,320.00 |
￥36,000.00 |
￥716,400.00 |
|
|
Free Delivery on orders over $200.00. |
|||||
|
We Devoted Ourselves To The Development Of Biomedical Research Reagent. |
|||||
