
PNGase F |
||||||
|
|
Cat.No.: |
CYT-P21163 |
|
|
|
Background |
||||||
PNGase F |
||||||
Measured by its ability to deglycosylate ribonuclease B under denatured conditions. >50% ribonuclease B (10 ¦Ìg) is deglycosylated by 2.4 ng rFmPNGase F within 60 minutes, as measured under the described conditions.Peptide -N-Glycosidase F, also known as PNGase F, is an amidase that cleaves between the innermost GlcNAc and asparagine residues of high mannose, hybrid, and complex oligosaccharides from N-linked glycoproteins. |
||||||
Information |
||||||
Source |
Escherichia coli. |
|||||
Molecular Weight |
Approximately 35KD. |
|||||
AA Sequence |
APADNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRY ANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKG REYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTT ISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWAPDR AGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPV VTN |
|||||
Unit Definition Assay |
10 ¦Ìg of RNase B are denatured with 1X Glycoprotein Denaturing Buffer (0.5% SDS, 40 mM DTT) at 100¡ãC for 10 minutes. After the addition of NP-40 and GlycoBuffer 2, two-fold dilutions of PNGase F are added and the reaction mix is incubated for 1 hour at 37¡ãC. Separation of reaction products are visualized by SDS-PAGE. |
|||||
Physical Appearance |
Sterile Filtered Clear Solution.. |
|||||
Formulation |
Supplied as a 0.2 ¦Ìm filtered solution of PBS, pH 7.4, 10% Glycerol. |
|||||
Endotoxin |
Less than 0.1 EU/mg of rHuEGF as determined by LAL method. |
|||||
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ¡Ü -20¡æ. Further dilutions should be made in appropriate buffered solutions. |
|||||
Purity |
> 95 % by SDS-PAGE and HPLC analyses. |
|||||
Stability & Storage |
It is recommended to freeze aliquots at -80¡ãC for extended storage. Avoid repeated freeze-thaw cycles. |
|||||
Stored at -80¡æ for 1 year. |
||||||
2 weeks, 2 to 8¡æunder sterile conditions after reconstitution. |
||||||
It is stable at -20¡æ for 3 months after opening. |
||||||
Usage Information |
|
|
|
|
|
|
This product is offered by BioCytoSci only for Scientific Research & Laboratory USE. NOT FOR OTHER USE. |
||||||
Order Information |
|
|
|
|
|
|
Cata.No. |
Quantity |
Price($) |
Price($) |
Availability |
||
CYT-P21163 |
5,000 units |
$156.00 |
€171.60 |
In stock |
||
CYT-P21163 |
15,000 units |
$296.00 |
€325.60 |
In stock |
||
CYT-P21163 |
75,000 units |
$1,300.00 |
€1,430.00 |
In stock |
||
Free Delivery on orders over $200.00. |
||||||
We Devoted Ourselves To The Development Of Biomedical Research Reagent. |